A1AG1_HUMAN P02763
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P02763
Recommended name：Alpha-1-acid glycoprotein 1
EC number：
Alternative names：(AGP 1) (Orosomucoid-1) (OMD 1)
Cleaved into：
GeneID：5004
Gene names (primary )：ORM1
Gene names (synonym )：AGP1
Gene names (ORF )：
Length：201
Mass：23512
Sequence：MALSWVLTVLSLLPLLEAQIPLCANLVPVPITNATLDQITGKWFYIASAFRNEEYNKSVQEIQATFFYFTPNKTEDTIFLREYQTRQDQCIYNTTYLNVQRENGTISRYVGGQEHFAHLLILRDTKTYMLAFDVNDEKNWGLSVYADKPETTKEQLGEFYEALDCLRIPKSDVVYTDWKKDKCEPLEKQHEKERKQEEGES
Tissue specificity：Expressed by the liver and secreted in plasma.
Induction：Synthesis is controlled by glucocorticoids, interleukin-1 and interleukin-6, It increases 5- to 50-fold upon inflammation.
Developmental stage：
Protein families：Calycin superfamily, Lipocalin family