RDH16_HUMAN O75452
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O75452
Recommended name：Retinol dehydrogenase 16
EC number：EC:1.1.1.105
Alternative names：(Human epidermal retinol dehydrogenase) (hRDH-E) (Microsomal NAD(+)-dependent retinol dehydrogenase 4) (RoDH-4) (Short chain dehydrogenase/reductase family 9C member 8) (Sterol/retinol dehydrogenase)
Cleaved into：
GeneID：8608
Gene names (primary )：RDH16
Gene names (synonym )：RODH4 SDR9C8
Gene names (ORF )：
Length：317
Mass：35673
Sequence：MWLYLAVFVGLYYLLHWYRERQVLSHLRDKYVFITGCDSGFGKLLARQLDARGLRVLAACLTEKGAEQLRGQTSDRLETVTLDVTKTESVAAAAQWVKECVRDKGLWGLVNNAGISLPTAPNELLTKQDFVTILDVNLLGVIDVTLSLLPLVRRARGRVVNVSSVMGRVSLFGGGYCISKYGVEAFSDSLRRELSYFGVKVAMIEPGYFKTAVTSKERFLKSFLEIWDRSSPEVKEAYGEKFVADYKKSAEQMEQKCTQDLSLVTNCMEHALIACHPRTRYSAGWDAKLLYLPMSYMPTFLVDAIMYWVSPSPAKAL
Tissue specificity：Highly expressed in adult liver (at protein level) (PubMed:9677409). Detected in endometrium, liver and foreskin (PubMed:10329026, PubMed:11967490). Detected in the spineous layers of adult skin, and at lower levels in basal and granular skin layers (PubMed:10329026). Detected in fetal liver and lung. {ECO:0000269|PubMed:10329026, ECO:0000269|PubMed:11967490, ECO:0000269|PubMed:9677409}.
Induction：Transiently up-regulated by retinoic acid. {ECO:0000269|PubMed:10329026}.
Developmental stage：
Protein families：Short-chain dehydrogenases/reductases (SDR) family