RBM3_HUMAN P98179
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P98179
Recommended name：RNA-binding protein 3
EC number：
Alternative names：(RNA-binding motif protein 3) (RNPL)
Cleaved into：
GeneID：5935
Gene names (primary )：RBM3
Gene names (synonym )：RNPL
Gene names (ORF )：
Length：157
Mass：17170
Sequence：MSSEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGESLDGRQIRVDHAGKSARGTRGGGFGAHGRGRSYSRGGGDQGYGSGRYYDSRPGGYGYGYGRSRDYNGRNQGGYDRYSGGNYRDNYDN
Tissue specificity：
Induction：Up-regulated by hypoxia. {ECO:0000269|PubMed:15075239}.
Developmental stage：
Protein families：