VTCN1_HUMAN Q7Z7D3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q7Z7D3
Recommended name：V-set domain-containing T-cell activation inhibitor 1
EC number：
Alternative names：(B7 homolog 4) (B7-H4) (B7h.5) (Immune costimulatory protein B7-H4) (Protein B7S1) (T-cell costimulatory molecule B7x)
Cleaved into：
GeneID：79679
Gene names (primary )：VTCN1
Gene names (synonym )：B7H4
Gene names (ORF )：UNQ659/PRO1291
Length：282
Mass：30878
Sequence：MASLGQILFWSIISIIIILAGAIALIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKASLCVSSFFAISWALLPLSPYLMLK
Tissue specificity：Overexpressed in breast, ovarian, endometrial, renal cell (RCC) and non-small-cell lung cancers (NSCLC). Expressed on activated T- and B-cells, monocytes and dendritic cells, but not expressed in most normal tissues (at protein level). Widely expressed, including in kidney, liver, lung, ovary, placenta, spleen and testis. {ECO:0000269|PubMed:12818165, ECO:0000269|PubMed:14568939, ECO:0000269|PubMed:15878339, ECO:0000269|PubMed:16606666, ECO:0000269|PubMed:16782226, ECO:0000269|PubMed:16798883, ECO:0000269|PubMed:17509674}.
Induction：Up-regulated by IL6/interleukin-6 and IL10/interleukin-10 and inhibited by CSF2/GM-CSF and IL4/interleukin-4 on antigen-presenting cells (APCs). {ECO:0000269|PubMed:16606666, ECO:0000269|PubMed:16785496, ECO:0000269|PubMed:17875732}.
Developmental stage：
Protein families：Immunoglobulin superfamily, BTN/MOG family