TM241_HUMAN   Q24JQ0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q24JQ0

Recommended name:Transmembrane protein 241

EC number:

Alternative names:

Cleaved into:

GeneID:85019

Gene names  (primary ):TMEM241

Gene names  (synonym ):C18orf45

Gene names  (ORF ):

Length:296

Mass:32647

Sequence:MCVRRSLVGLTFCTCYLASYLTNKYVLSVLKFTYPTLFQGWQTLIGGLLLHVSWKLGWVEINSSSRSHVLVWLPASVLFVGIIYAGSRALSRLAIPVFLTLHNVAEVIICGYQKCFQKEKTSPAKICSALLLLAAAGCLPFNDSQFNPDGYFWAIIHLLCVGAYKILQKSQKPSALSDIDQQYLNYIFSVVLLAFASHPTGDLFSVLDFPFLYFYRFHGSCCASGFLGFFLMFSTVKLKNLLAPGQCAAWIFFAKIITAGLSILLFDAILTSATTGCLLLGALGEALLVFSERKSS

Tissue specificity:

Induction:Up-regulated by inducers of the unfolded protein response (UPR), including tunicamycin and thapsigargin. {ECO:0000269|PubMed:23027870}.

Developmental stage:

Protein families:TMEM241 family


   💬 WhatsApp