LOX15_HUMAN P16050
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P16050
Recommended name：Polyunsaturated fatty acid lipoxygenase ALOX15
EC number：
Alternative names：(12/15-lipoxygenase) (Arachidonate 12-lipoxygenase, leukocyte-type) (12-LOX) (EC 1.13.11.31) (Arachidonate 15-lipoxygenase) (15-LOX) (15-LOX-1) (EC 1.13.11.33) (Arachidonate omega-6 lipoxygenase) (Hepoxilin A3 synthase Alox15) (EC 1.13.11.-) (Linoleate 13S-lipoxygenase) (EC 1.13.11.12)
Cleaved into：
GeneID：246
Gene names (primary )：ALOX15
Gene names (synonym )：LOG15
Gene names (ORF )：
Length：662
Mass：74804
Sequence：MGLYRIRVSTGASLYAGSNNQVQLWLVGQHGEAALGKRLWPARGKETELKVEVPEYLGPLLFVKLRKRHLLKDDAWFCNWISVQGPGAGDEVRFPCYRWVEGNGVLSLPEGTGRTVGEDPQGLFQKHREEELEERRKLYRWGNWKDGLILNMAGAKLYDLPVDERFLEDKRVDFEVSLAKGLADLAIKDSLNVLTCWKDLDDFNRIFWCGQSKLAERVRDSWKEDALFGYQFLNGANPVVLRRSAHLPARLVFPPGMEELQAQLEKELEGGTLFEADFSLLDGIKANVILCSQQHLAAPLVMLKLQPDGKLLPMVIQLQLPRTGSPPPPLFLPTDPPMAWLLAKCWVRSSDFQLHELQSHLLRGHLMAEVIVVATMRCLPSIHPIFKLIIPHLRYTLEINVRARTGLVSDMGIFDQIMSTGGGGHVQLLKQAGAFLTYSSFCPPDDLADRGLLGVKSSFYAQDALRLWEIIYRYVEGIVSLHYKTDVAVKDDPELQTWCREITEIGLQGAQDRGFPVSLQARDQVCHFVTMCIFTCTGQHASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASLQMSITWQLGRRQPVMVAVGQHEEEYFSGPEPKAVLKKFREELAALDKEIEIRNAKLDMPYEYLRPSVVENSVAI
Tissue specificity：Detected in monocytes and eosinophils (at protein level). Expressed in airway epithelial cells. {ECO:0000269|PubMed:21831839, ECO:0000269|PubMed:9414270}.
Induction：Up-regulated by UV-irradiation. {ECO:0000269|PubMed:18755188}.
Developmental stage：
Protein families：Lipoxygenase family