CDKN3_HUMAN Q16667
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q16667
Recommended name：Cyclin-dependent kinase inhibitor 3
EC number：EC:3.1.3.16
Alternative names：(CDK2-associated dual-specificity phosphatase) (Cyclin-dependent kinase interactor 1) (Cyclin-dependent kinase-interacting protein 2) (Kinase-associated phosphatase)
Cleaved into：
GeneID：1033
Gene names (primary )：CDKN3
Gene names (synonym )：CDI1 CIP2 KAP
Gene names (ORF )：
Length：212
Mass：23805
Sequence：MKPPSSIQTSEFDSSDEEPIEDEQTPIHISWLSLSRVNCSQFLGLCALPGCKFKDVRRNVQKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCGIITHHHPIADGGTPDIASCCEIMEELTTCLKNYRKTLIHCYGGLGRSCLVAACLLLYLSDTISPEQAIDSLRDLRGSGAIQTIKQYNYLHEFRDKLAAHLSSRDSQSRSVSR
Tissue specificity：
Induction：Up-regulated in breast and prostate cancer cells. {ECO:0000269|PubMed:10669749}.
Developmental stage：
Protein families：Protein-tyrosine phosphatase family