ENTP5_HUMAN O75356
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O75356
Recommended name：Ectonucleoside triphosphate diphosphohydrolase 5
EC number：EC:3.6.1.6
Alternative names：(NTPDase 5) (CD39 antigen-like 4) (ER-UDPase) (Guanosine-diphosphatase ENTPD5) (GDPase ENTPD5) (Nucleoside diphosphatase) (Uridine-diphosphatase ENTPD5) (UDPase ENTPD5)
Cleaved into：
GeneID：957
Gene names (primary )：ENTPD5
Gene names (synonym )：CD39L4 PCPH
Gene names (ORF )：
Length：428
Mass：47517
Sequence：MATSWGTVFFMLVVSCVCSAVSHRNQQTWFEGIFLSSMCPINVSASTLYGIMFDAGSTGTRIHVYTFVQKMPGQLPILEGEVFDSVKPGLSAFVDQPKQGAETVQGLLEVAKDSIPRSHWKKTPVVLKATAGLRLLPEHKAKALLFEVKEIFRKSPFLVPKGSVSIMDGSDEGILAWVTVNFLTGQLHGHRQETVGTLDLGGASTQITFLPQFEKTLEQTPRGYLTSFEMFNSTYKLYTHSYLGFGLKAARLATLGALETEGTDGHTFRSACLPRWLEAEWIFGGVKYQYGGNQEGEVGFEPCYAEVLRVVRGKLHQPEEVQRGSFYAFSYYYDRAVDTDMIDYEKGGILKVEDFERKAREVCDNLENFTSGSPFLCMDLSYITALLKDGFGFADSTVLQLTKKVNNIETGWALGATFHLLQSLGISH
Tissue specificity：Expressed in adult liver, kidney, prostate, testis and colon. Much weaker expression in other tissues. {ECO:0000269|PubMed:9676430}.
Induction：Up-regulated in cell lines and primary tumor samples with active AKT1. {ECO:0000269|PubMed:21074248}.
Developmental stage：
Protein families：GDA1/CD39 NTPase family