FA72D_HUMAN Q6L9T8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6L9T8
Recommended name：Protein FAM72D
EC number：
Alternative names：(Gastric cancer up-regulated protein 2)
Cleaved into：
GeneID：728833
Gene names (primary )：FAM72D
Gene names (synonym )：GCUD2
Gene names (ORF )：
Length：149
Mass：16688
Sequence：MSTNICSFKDRCVSILCCKFCKQVLSSRGMKAVLLADTEIDLFSTDIPPTNAVDFTGRCYFTKICKCKLKDIACLKCGNIVGYHVIVPCSSCLLSCNNRHFWMFHSQAVYDINRLDSTGVNVLLRGNLPEIEESTDEDVLNISAEECIR
Tissue specificity：
Induction：Up-regulated in gastric cancer.
Developmental stage：
Protein families：FAM72 family