DENR_HUMAN O43583
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O43583
Recommended name：Density-regulated protein
EC number：
Alternative names：(DRP) (Protein DRP1) (Smooth muscle cell-associated protein 3) (SMAP-3)
Cleaved into：
GeneID：8562
Gene names (primary )：DENR
Gene names (synonym )：DRP1
Gene names (ORF )：H14
Length：198
Mass：22092
Sequence：MAADISESSGADCKGDPRNSAKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAKLTVENSPKQEAGISEGQGTAGEEEEKKKQKRGGRGQIKQKKKTVPQKVTIAKIPRAKKKYVTRVCGLATFEIDLKEAQRFFAQKFSCGASVTGEDEIIIQGDFTDDIIDVIQEKWPEVDDDSIEDLGEVKK
Tissue specificity：Highly expressed in heart and skeletal muscle and moderately expressed in the brain, placenta, liver and pancreas. Weakly expressed in the lung and kidney. {ECO:0000269|PubMed:9628587}.
Induction：Up-regulated with increasing cell-density by HNRNPD. Up-regulated in ovarian and breast cancer cells by ERBB2 overexpression. Not induced by TGFB1. {ECO:0000269|PubMed:10497265, ECO:0000269|PubMed:17878526, ECO:0000269|PubMed:9628587}.
Developmental stage：
Protein families：DENR family