SPNXA_HUMAN   Q9NS26


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9NS26

Recommended name:Sperm protein associated with the nucleus on the X chromosome A

EC number:

Alternative names:(Cancer/testis antigen 11.1) (CT11.1) (Nuclear-associated protein SPAN-Xa) (SPAN-X) (SPANX-A) (SPANX family member A)

Cleaved into:

GeneID:30014

Gene names  (primary ):SPANXA1; SPANXA2

Gene names  (synonym ):SPANXA;

Gene names  (ORF ):;

Length:97

Mass:11038

Sequence:MDKQSSAGGVKRSVPCDSNEANEMMPETPTGDSDPQPAPKKMKTSESSTILVVRYRRNFKRTSPEELLNDHARENRINPLQMEEEEFMEIMVEIPAK

Tissue specificity:Detected in testis and sperm. {ECO:0000269|PubMed:10906052, ECO:0000269|PubMed:12758128}.

Induction:

Developmental stage:Detected in round and elongating spermatids. {ECO:0000269|PubMed:10906052, ECO:0000269|PubMed:12758128}.

Protein families:SPAN-X family


   💬 WhatsApp