PTOV1_HUMAN Q86YD1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q86YD1
Recommended name：Prostate tumor-overexpressed gene 1 protein
EC number：
Alternative names：(PTOV-1) (Activator interaction domain-containing protein 2)
Cleaved into：
GeneID：53635
Gene names (primary )：PTOV1
Gene names (synonym )：ACID2
Gene names (ORF )：PP642 UNQ6127/PRO20092
Length：416
Mass：46869
Sequence：MVRPRRAPYRSGAGGPLGGRGRPPRPLVVRAVRSRSWPASPRGPQPPRIRARSAPPMEGARVFGALGPIGPSSPGLTLGGLAVSEHRLSNKLLAWSGVLEWQEKRRPYSDSTAKLKRTLPCQAYVNQGENLETDQWPQKLIMQLIPQQLLTTLGPLFRNSQLAQFHFTNRDCDSLKGLCRIMGNGFAGCMLFPHISPCEVRVLMLLYSSKKKIFMGLIPYDQSGFVSAIRQVITTRKQAVGPGGVNSGPVQIVNNKFLAWSGVMEWQEPRPEPNSRSKRWLPSHVYVNQGEILRTEQWPRKLYMQLIPQQLLTTLVPLFRNSRLVQFHFTKDLETLKSLCRIMDNGFAGCVHFSYKASCEIRVLMLLYSSEKKIFIGLIPHDQGNFVNGIRRVIANQQQVLQRNLEQEQQQRGMGG
Tissue specificity：Expressed in brain, heart, kidney, liver, placenta, skeletal muscle and small intestine. {ECO:0000269|PubMed:11313889}.
Induction：By testosterone. {ECO:0000269|PubMed:16639697}.
Developmental stage：Expressed at low levels in quiescent cells. Expression rises upon entry into S-phase. {ECO:0000269|PubMed:15713644}.
Protein families：Mediator complex subunit 25 family, PTOV1 subfamily