SPR1B_HUMAN P22528
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P22528
Recommended name：Cornifin-B
EC number：
Alternative names：(14.9 kDa pancornulin) (Small proline-rich protein IB) (SPR-IB)
Cleaved into：
GeneID：6699
Gene names (primary )：SPRR1B
Gene names (synonym )：
Gene names (ORF )：
Length：89
Mass：9888
Sequence：MSSQQQKQPCTPPPQLQQQQVKQPCQPPPQEPCIPKTKEPCHPKVPEPCHPKVPEPCQPKVPEPCHPKVPEPCPSIVTPAPAQQKTKQK
Tissue specificity：Suprabasal layers of squamous-differentiated tissues such as epidermis, esophagus, tongue and trachea.
Induction：By carcinogenic agents and by UV light. During squamous differentiation of epidermal keratinocytes.
Developmental stage：Expressed during differentiation of squamous cells.
Protein families：Cornifin (SPRR) family