NFU1_HUMAN   Q9UMS0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9UMS0

Recommended name:NFU1 iron-sulfur cluster scaffold homolog, mitochondrial

EC number:

Alternative names:(HIRA-interacting protein 5)

Cleaved into:

GeneID:27247

Gene names  (primary ):NFU1

Gene names  (synonym ):HIRIP5

Gene names  (ORF ):CGI-33

Length:254

Mass:28463

Sequence:MAATARRGWGAAAVAAGLRRRFCHMLKNPYTIKKQPLHQFVQRPLFPLPAAFYHPVRYMFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDFITVTKENEELDWNLLKPDIYATIMDFFASGLPLVTEETPSGEAGSEEDDEVVAMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQFYIPEVEGVEQVMDDESDEKEANSP

Tissue specificity:Ubiquitous. Expression in adult lung is weak compared to fetal lung. {ECO:0000269|PubMed:12915448}.

Induction:

Developmental stage:Expressed in embryo and adult. {ECO:0000269|PubMed:12915448}.

Protein families:NifU family


   💬 WhatsApp