TARG1_HUMAN Q8IXB3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8IXB3
Recommended name：Trafficking regulator of GLUT4 1
EC number：
Alternative names：(Dispanin subfamily B member 1) (DSPB1) (Interferon-induced transmembrane domain-containing protein D3) (Protein located at seventeen-p-thirteen point three 1) (Tumor suppressor candidate 5)
Cleaved into：
GeneID：286753
Gene names (primary )：TRARG1
Gene names (synonym )：IFITMD3 LOST1 TUSC5
Gene names (ORF )：
Length：177
Mass：19254
Sequence：MAHPVQSEFPSAQEPGSAAFLDLPEMEILLTKAENKDDKTLNLSKTLSGPLDLEQNSQGLPFKAISEGHLEAPLPRSPSRASSRRASSIATTSYAQDQEAPRDYLILAVVACFCPVWPLNLIPLIISIMSRSSMQQGNVDGARRLGRLARLLSITLIIMGIVIIMVAVTVNFTVQKK
Tissue specificity：Expressed at high levels in heart, mammary gland, adrenal gland, stomach, smooth muscle and skeletal muscle, and at lower levels in brain and lung. Strongly down-regulated in lung cancer tissues, due to hypermethylation of the corresponding locus (PubMed:12660825). Expressed in adipose tissue (PubMed:26629404). {ECO:0000269|PubMed:12660825, ECO:0000269|PubMed:26629404}.
Induction：
Developmental stage：Expressed in fetal brain. {ECO:0000269|PubMed:12660825}.
Protein families：CD225/Dispanin family