DEPP1_HUMAN Q9NTK1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9NTK1
Recommended name：Protein DEPP1
EC number：
Alternative names：(Decidual protein induced by progesterone) (Fasting-induced gene protein) (FIG)
Cleaved into：
GeneID：11067
Gene names (primary )：DEPP1
Gene names (synonym )：C10orf10 DEPP FIG
Gene names (ORF )：
Length：212
Mass：23406
Sequence：MRSRLLLSVAHLPTIRETTEEMLLGGPGQEPPPSPSLDDYVRSISRLAQPTSVLDKATAQGQPRPPHRPAQACRKGRPAVSLRDITARFSGQQPTLPMADTVDPLDWLFGESQEKQPSQRDLPRRTGPSAGLWGPHRQMDSSKPMGAPRGRLCEARMPGHSLARPPQDGQQSSDLRSWTFGQSAQAMASRHRPRPSSVLRTLYSHLPVIHEL
Tissue specificity：Expressed in various tissues, including pancreas, placenta, ovary, testis and kidney. {ECO:0000269|PubMed:16123073}.
Induction：By progesterone, testosterone and, to a much lower extent, estrogen. Induced by oxidative stress via FOXO3 activation (PubMed:28545464). Up-regulated by hypoxia (at protein level). {ECO:0000269|PubMed:16123073, ECO:0000269|PubMed:21510935, ECO:0000269|PubMed:28545464}.
Developmental stage：High levels in first trimester deciduas. Higher levels in the endometria during secretory phase than the proliferative phase, especially after the mid-secretory phase. {ECO:0000269|PubMed:16123073}.
Protein families：