PHB2_HUMAN Q99623
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q99623
Recommended name：Prohibitin-2
EC number：
Alternative names：(B-cell receptor-associated protein BAP37) (D-prohibitin) (Repressor of estrogen receptor activity)
Cleaved into：
GeneID：11331
Gene names (primary )：PHB2
Gene names (synonym )：BAP REA
Gene names (ORF )：
Length：299
Mass：33296
Sequence：MAQNLKDLAGRLPAGPRGMGTALKLLLGAGAVAYGVRESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK
Tissue specificity：
Induction：Expression increases approximately 3-fold upon entry into G1 phase compared to other phases of the cell cycle. Also induced following inhibition of mitochondrial protein synthesis by thiamphenicol. {ECO:0000269|PubMed:11302691}.
Developmental stage：Levels of expression in fibroblasts decrease heterogeneously during cellular aging. {ECO:0000269|PubMed:11302691}.
Protein families：Prohibitin family