NXPH3_MOUSE   Q91VX5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q91VX5

Recommended name:Neurexophilin-3

EC number:

Alternative names:

Cleaved into:

GeneID:104079

Gene names  (primary ):Nxph3

Gene names  (synonym ):

Gene names  (ORF ):

Length:252

Mass:28183

Sequence:MQLTRCCFVFLVQGSLYLVICGQDDGPPGSEDPEHDDHEGQPRPRVPRKRGHISPKSRPLANSTLLGLLAPPGEVWGVLGQPPNRPKQSPLPSTKVKKIFGWGDFYSNIKTVALNLLVTGKIVDHGNGTFSVHFRHNATGQGNISISLVPPSKAVEFHQEQQIFIEAKASKIFNCRMEWEKVERGRRTSLCTHDPAKICSRDHAQSSATWSCSQPFKVVCVYIAFYSTDYRLVQKVCPDYNYHSDTPYYPSG

Tissue specificity:Highest level in brain, present also in lung, kidney and testis. {ECO:0000269|PubMed:9570794}.

Induction:

Developmental stage:

Protein families:Neurexophilin family


   💬 WhatsApp