C1QT7_MOUSE   Q8BVD7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8BVD7

Recommended name:Complement C1q tumor necrosis factor-related protein 7

EC number:

Alternative names:

Cleaved into:

GeneID:109323

Gene names  (primary ):C1qtnf7

Gene names  (synonym ):Ctrp7

Gene names  (ORF ):

Length:289

Mass:30517

Sequence:MIVLLYVTSLAICASGQPRANQAKGESYSPRYICSIPGLPGPPGPPGANGSPGPHGRIGLPGRDGRDGRKGEKGEKGTAGLKGKTGPLGLAGEKGDQGETGKKGPIGPEGEKGEVGPAGPPGPKGDRGDQGDPGLPGVCRCGSIVLKSAFSVGITTSYPEERLPIIFNKVLFNEGEHYNPATGKFICAFPGIYYFSYDITLANKHLAIGLVHNGQYRIRTFDANTGNHDVASGSTVIYLQPEDEVWLEIFFNDQNGLFSDPGWADSLFSGFLLYVDTDYLDSISEDDEL

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp