RHOD_MOUSE   P97348


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P97348

Recommended name:Rho-related GTP-binding protein RhoD

EC number:

Alternative names:

Cleaved into:

GeneID:11854

Gene names  (primary ):Rhod

Gene names  (synonym ):Arhd Rhom

Gene names  (ORF ):

Length:210

Mass:23562

Sequence:MNASQVAGEEAPQSGHSVKVVLVGDGGCGKTSLMMVFAKGAFPESYSPTVFERYNATLQMKGKPVHLQIWDTAGQDDYDRLRPLFYPDANVLLLCFDVTNPNSFDNVSNRWYPEVTHFCKGVPIIVVGCKIDLRKDKVLVNNLRKKRLEPVTYHRGHDMARSVGAVAYLECSARLHDNVEAVFQEAAEVALSSRRHNFWRRITQNCCLAT

Tissue specificity:Widely expressed.

Induction:

Developmental stage:

Protein families:Small GTPase superfamily, Rho family


   💬 WhatsApp