RAB18_MOUSE P35293
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P35293
Recommended name：Ras-related protein Rab-18
EC number：
Alternative names：
Cleaved into：
GeneID：19330
Gene names (primary )：Rab18
Gene names (synonym )：
Gene names (ORF )：
Length：206
Mass：23035
Sequence：MDEDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKENREVDRNEGLKFARKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREESRGGGACGGYCSVL
Tissue specificity：Expression is high in the brain, moderate in the pituitary, and low in the liver. Detected in all tissues. Highly enriched on apical endocytic structures in polarized epithelial cells of kidney proximal tubules. Detected on both the apical and basolateral domains in epithelial cells of the intestine. {ECO:0000269|PubMed:7706395, ECO:0000269|PubMed:7916717}.
Induction：
Developmental stage：
Protein families：Small GTPase superfamily, Rab family