SPR2K_MOUSE   O70562


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O70562

Recommended name:Small proline-rich protein 2K

EC number:

Alternative names:

Cleaved into:

GeneID:20765

Gene names  (primary ):Sprr2k

Gene names  (synonym ):

Gene names  (ORF ):

Length:68

Mass:7499

Sequence:MSYQEQQCKQLCQPLPVCPPPKPCSPPKCPEPCPPPKCPETCPPQPCQRKCPPVLEAPCQQKCPSKSK

Tissue specificity:Not expressed in uterus. {ECO:0000269|PubMed:15232223}.

Induction:

Developmental stage:

Protein families:Cornifin (SPRR) family


   💬 WhatsApp