F126B_MOUSE   Q8C729


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8C729

Recommended name:Protein FAM126B

EC number:

Alternative names:

Cleaved into:

GeneID:213056

Gene names  (primary ):Fam126b

Gene names  (synonym ):D1Ertd53e

Gene names  (ORF ):

Length:530

Mass:58587

Sequence:MLGSERAVVEEWLSEFKALPDTQITSYAATLHRKKALVPALYKVIQDSNNELLEPVCHQLFELYRSSEVRLKRFTLQFLPELIWVYLRLTVSRDRQSNGCIEALLLGIYNLEIADKDGNNKVLSFTIPSLSKPSIYHEPSTIGSMALTEGALCQHDLIRVVYSDLHPQRETFTAQNRFEVLSFLMLCYNSAIVYMPASSYQSLCRMGSRVCVSGFPRQHEKQWKELCGRIVLDPEFMVQLLTGVYYAMYNGQWDLGQEVLDDIIYRAQLELFSQPLLVANAMKNSLPFDAPDSSQEGQKVLKVEVTPTVPRISRTAITTASIRRHRWRREGAEGLNGGEESLNMNDADEGFSSGASLSSQPHGTKPPSSSQRGSLRKVATGRSAKDKETALAIKSNESPRDSVVGKQFVQQQADLSIDSVELTPMKKHLSLPAGQVVPKTNSLSLIRTASASSSKSFDYVNGGQASTSIGVGTEGVTNLAATNANRYSTISLQEDRLGHAGEGKELLSPGAPLTKQSRSPSFNMQLISQV

Tissue specificity:Expressed in the central nervous system. Expressed at much lower level in oligodendrocytes than in neurons. {ECO:0000269|PubMed:26571211}.

Induction:

Developmental stage:

Protein families:FAM126 family


   💬 WhatsApp