CLIC5_MOUSE Q8BXK9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8BXK9
Recommended name：Chloride intracellular channel protein 5
EC number：
Alternative names：
Cleaved into：
GeneID：224796
Gene names (primary )：Clic5
Gene names (synonym )：
Gene names (ORF )：
Length：251
Mass：28287
Sequence：MTDSATTNGDDRDPEIELFVKAGIDGESIGNCPFSQRLFMILWLKGVVFNVTTVDLKRKPADLHNLAPGTHPPFLTFNGDVKTDVNKIEEFLEETLTPEKYPKLAAKHRESNTAGIDIFSKFSAYIKNTKQQNNAALERGLTKALRKLDDYLNSPLPEEIDTNTHGDEKGSQRKFLDGDELTLADCNLLPKLHVVKIVAKKYRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYADVARRLSRS
Tissue specificity：Detected in lung and inner ear. Detected in embryonic cochlea, on microvilli-covered apical surfaces of interdental cells, columnar cells of Kolliker's organ, and on stereocilia of inner and outer hair cells (at protein level) (PubMed:17021174). Also detected in the eye, where it localizes to lens fiber cells in the lens epithelium (at protein level) (PubMed:29425878). {ECO:0000269|PubMed:17021174, ECO:0000269|PubMed:29425878}.
Induction：
Developmental stage：
Protein families：Chloride channel CLIC family