KLRE1_MOUSE Q8CJC7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8CJC7
Recommended name：Killer cell lectin-like receptor subfamily E member 1
EC number：
Alternative names：
Cleaved into：
GeneID：243655
Gene names (primary )：Klre1
Gene names (synonym )：NKG2I
Gene names (ORF )：
Length：226
Mass：26265
Sequence：MDEAPVTRSTLNVNSQQKSKAKNKIKNTLNSNELSSIEQRKKYQKHLKKHKNTAEDISGKGNCSPPWRLLSSVLGAMCLLLMAVAMVMTTFTTKSSSERSSSTIQQEGLHHPCPENWVWFRCSCYFFSKEELIWRDSQRACLSLNSSLIRMNKEEMNFFSLKSFFWVGVYYNETRRQWLWEDHSVLPSGLFSKLEANMKNFCASYKSKEAYMEENCANKLTYICKK
Tissue specificity：Expressed in natural killer (NK) cells (at protein level) (PubMed:12782717, PubMed:14707119, PubMed:12715246). Also detected in natural killer T (NKT) cells (at protein level) (PubMed:14707119, PubMed:12715246). Has little or no expression in T cells (at protein level) (PubMed:14707119, PubMed:12715246). {ECO:0000269|PubMed:12715246, ECO:0000269|PubMed:12782717, ECO:0000269|PubMed:14707119}.
Induction：
Developmental stage：
Protein families：