OD3L1_MOUSE   Q810P2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q810P2

Recommended name:Outer dense fiber protein 3-like protein 1

EC number:

Alternative names:

Cleaved into:

GeneID:382075

Gene names  (primary ):Odf3l1

Gene names  (synonym ):

Gene names  (ORF ):

Length:275

Mass:31064

Sequence:MKQSKGSRNYVFYAQHPEKEEEVPSWHEIKQTPVIMATIKGPGPAKYLRSSCTGYIAHDISMFQEPAYSLHTRHTKKRIIDINSPGPCYFLNPKVTRFGISTCPQVPMEERISNPRINCMPASCKYNLEKTRPSGERQPPQYTFGYRCPYRVMDPNPAPNQYQLPVTLGTNIPVFRAAPSYSLASTNKNWFHKENIAGGPGPAMHTRPEPSVYQNRSPLFSMAKRFGCPLDHTHRPGPGSHDIQPVTVHKPRIPAFTMGIKHSPHLCPLIVDICD

Tissue specificity:

Induction:

Developmental stage:

Protein families:ODF3 family


   💬 WhatsApp