CSN9_MOUSE   Q3U898


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q3U898

Recommended name:COP9 signalosome complex subunit 9

EC number:

Alternative names:

Cleaved into:

GeneID:66915

Gene names  (primary ):Cops9

Gene names  (synonym ):Myeov2

Gene names  (ORF ):

Length:57

Mass:6197

Sequence:MKPAVDEMFPEGAGPYVDLDEAGGSTGLLMDLAANEKAVHADFFNDFEDLFDDDDVQ

Tissue specificity:

Induction:

Developmental stage:

Protein families:CSN9 family


   💬 WhatsApp