RLA2_MOUSE   P99027


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P99027

Recommended name:60S acidic ribosomal protein P2

EC number:

Alternative names:

Cleaved into:

GeneID:67186

Gene names  (primary ):Rplp2

Gene names  (synonym ):

Gene names  (ORF ):

Length:115

Mass:11651

Sequence:MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGVGKLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEKKDEKKEESEESDDDMGFGLFD

Tissue specificity:

Induction:

Developmental stage:

Protein families:Eukaryotic ribosomal protein P1/P2 family


   💬 WhatsApp