TCIM_MOUSE Q9D915
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9D915
Recommended name：Transcriptional and immune response regulator
EC number：
Alternative names：
Cleaved into：
GeneID：69068
Gene names (primary )：Tcim
Gene names (synonym )：Tc1
Gene names (ORF )：
Length：106
Mass：12215
Sequence：MKAKPSHQATSMSSSLRVSPSIHGYHFDTAARKKAVGNIFENIDQESLQRLFRNSGDKKAEERAKIIFAIDQDLEEKTRALMALKKRTKDKLLQFLKLRKYSIKVH
Tissue specificity：Expressed in liver, expression levels decrease in regenerating liver (PubMed:25985737). In bone marrow, expressed in large progenitor-like cells, cells with ring-shaped nuclei and, at lower, levels in hematopietic stem cell-like cells with round nuclei (at protein level) (PubMed:24937306). {ECO:0000269|PubMed:24937306, ECO:0000269|PubMed:25985737}.
Induction：
Developmental stage：
Protein families：