FAKD3_MOUSE Q8BSN9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8BSN9
Recommended name：FAST kinase domain-containing protein 3, mitochondrial
EC number：
Alternative names：
Cleaved into：
GeneID：69577
Gene names (primary )：Fastkd3
Gene names (synonym )：
Gene names (ORF )：
Length：661
Mass：75317
Sequence：MAFITLRRAFCHKSILWIPGAVVALKIHPASHAPKAVTDRLSVCFCSLQPELFRVRFHHAYCKNFHSEKGNDFHPVGEPWSSQAQEWNQPGQSLQNEDEEMLFRRLSYFTSFEEVLSFISALDTLPVPLAMAALLRICEIGRRDGEQRLPEGVLENRAFQALCLRCERDPSHLTNAGLVTALQSLLTLLPADPQSSLMLSLVAECQRRLQRGNLEVHHLCVLGESLAMLQGASCETLKLVVRQLQSKSVETFAPEEITSVYRILQVCPEEVDKHQMFLNTLNNFSISVVPYLSPKSISHVLTALVALDQTHALPLLIKLGKYVVRYIPRFTNEELRKVLEAFVYFGHSDRFFTEALEQHVSALCFSLDPAVASSVMGYCSRKRILSKPIFDVVSEIVVCQWDRLSPSQIAELIEPFGKLNYVPPNAPALFRKVENVLCARLHHFPPKMLLRLLHSCALIERHPVNFMSKLFSPFFLQRLQGKESYLDRLSLAQLTQLFLTSVLECPFYKGPKLLPKYQVKSFLTPCCSLETPLDLHLYKSVVIGLIDLLGSRLYFASKVLTPYYYTIDVEVKLDEDGFVLPCTVDEDIHKRVALCIDGPQRFCLDSKHLLGKEATKQRHLRLLGYQVVQLPYHELELLTSRLELVDYLQRKLFSQSSAVHW
Tissue specificity：Expression detected in spleen, testis, colon, heart, smooth muscle, kidney, brain, lung, liver, brown and white adipose tissue with highest expression in testis and smooth muscle. {ECO:0000269|PubMed:20869947}.
Induction：
Developmental stage：
Protein families：FAST kinase family