RAB3B_MOUSE   Q9CZT8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9CZT8

Recommended name:Ras-related protein Rab-3B

EC number:

Alternative names:

Cleaved into:

GeneID:69908

Gene names  (primary ):Rab3b

Gene names  (synonym ):

Gene names  (ORF ):

Length:219

Mass:24757

Sequence:MASVTDGKTGIKDASDQNFDYMFKLLIIGNSSVGKTSFLFRYADDTFTPAFVSTVGIDFKVKTVYRHEKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWATQIKTYSWDNAQVILVGNKCDMEEERVVPTEKGRLLAEQLGFDFFEASAKENISVRQAFERLVDAICDKMSDSMDTDPSVLGASKTTRLSDTPPLLQQNCSC

Tissue specificity:Abundantly expressed in testis, lung and brain. {ECO:0000269|PubMed:18396146}.

Induction:

Developmental stage:

Protein families:Small GTPase superfamily, Rab family


   💬 WhatsApp