LYPD8_MOUSE Q9D7S0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9D7S0
Recommended name：Ly6/PLAUR domain-containing protein 8
EC number：
Alternative names：
Cleaved into：
GeneID：70163
Gene names (primary )：Lypd8
Gene names (synonym )：
Gene names (ORF )：
Length：255
Mass：27524
Sequence：MRGVFIAGVIAAFAITVVDSLNCTQCYTYNSTCDGQATECNEQSFSCVESSINSTLGGFLHVYQNKFCSASNCTENSTEVAFTVHLFDDQRYHFASQCCQGESCNATHSESGTQNVTDMQCMSCYGHNKTLCEEKPQKCYEGEQCVFIIAEMVNGSGRVELKGCSDISNSTCQFLSPGNTTVGEFVFKSVECTQPTEYTNSTTTIPPITNTSLTSVTRPGIKTSPASVTPQASMGTKASFTSSIFGSLLLLKLLF
Tissue specificity：Specifically present in enterocytes located at the uppermost epithelial layer of the colon (at protein level). Exclusively expressed in the large intestine: specifically expressed on the apical surface of epithelial cells located at the uppermost layer of the colonic gland. {ECO:0000269|PubMed:27027293}.
Induction：
Developmental stage：
Protein families：CNF-like-inhibitor family