TERB2_MOUSE   Q9D494


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9D494

Recommended name:Telomere repeats-binding bouquet formation protein 2

EC number:

Alternative names:

Cleaved into:

GeneID:74401

Gene names  (primary ):Terb2

Gene names  (synonym ):

Gene names  (ORF ):

Length:218

Mass:25030

Sequence:MFQGQRGWFCGSVSQDLRQIWEDEGGMVSDVKAADFLFSCDASHPDTLRIYQSLEYIEDNATVFHAYYLAAIANTEMKNSVALGHFVLPPACLQKEIRRKIGSFIWEQDEKFQIEKHDRMASSDKENIRPTPEHKQELSKSAEHHLTRTPVIEKQMCFPLHSYPVNNMVTGYISIDALEKFLGELHDFTPGSSGYLAYHIQDEINMSAIKNKLRRKLS

Tissue specificity:Specifically expressed in germline tissues. {ECO:0000269|PubMed:26548954}.

Induction:

Developmental stage:

Protein families:TERB2 family


   💬 WhatsApp