GPR87_MOUSE   Q99MT7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q99MT7

Recommended name:G-protein coupled receptor 87

EC number:

Alternative names:

Cleaved into:

GeneID:84111

Gene names  (primary ):Gpr87

Gene names  (synonym ):

Gene names  (ORF ):

Length:358

Mass:41414

Sequence:MGLNLTLTKLPGNELYSQASHTANSTSEGHGKNSTLHNKFDTIILPVLYLVIFVASILLNGLAVWIFFHIRNKTSFIFYLKNIVVADLIMTLTFPFRIVRDAGFGPWYFEFILCRYTSVLFYANMYTSIVFLGLISVDRYLKVVKPFGDSRMYSITFTKVLSVCVWVIMAILSLPNIILTNGQPTKENIHDCMKLKSPLGAKWHMAVTYVDSCLFVAVLVILIGCYIAISRYIHKSSRQFISQSSRKRKHNQSIRVVVAVFFTCFLPYHLCRIPFTFSNLDRLLDESAHKILYYCKEMTLFLSACNVCLDPIIYFFMCKSFSRRLFKKSNIRTRSESIRSLQSVRRSEVRIYYDYTDV

Tissue specificity:Expressed at high levels in testis and brain and to a lesser extent placenta, ovary, prostate, and skeletal muscle but not in heart, lung, kidney, liver or intestine. {ECO:0000269|PubMed:17905198}.

Induction:

Developmental stage:

Protein families:G-protein coupled receptor 1 family


   💬 WhatsApp