IGHDM_MOUSE   P01882


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P01882

Recommended name:Ig delta chain C region membrane-bound form

EC number:

Alternative names:

Cleaved into:

GeneID:

Gene names  (primary ):

Gene names  (synonym ):

Gene names  (ORF ):

Length:290

Mass:32353

Sequence:DKKEPDMFLLSECKAPEENEKINLGCLVIGSQPLKISWEPKKSSIVEHVFPSEMRNGNYTMVLQVTVLASELNLNHTCTINKPKRKEKPFKFPESWDSQSSKRVTPTLQAKNHSTEATKAITTKKDIEGAMAPSNLTVNILTTSTHPEMSSWLLCEVSGFFPENIHLMWLGVHSKMKSTNFVTANPTAQPGGTFQTWSVLRLPVALSSSLDTYTCVVEHEASKTKLNASKSLAISGIVNTIQHSCIMDEQSDSYMDLEEENGLWPTMCTFVALFLLTLLYSGFVTFIKVK

Tissue specificity:Cell lines producing IgD contain several mRNA species for Ig delta chains. In plasmacytomas, the secreted form is the major component, and the membrane-bound form is a minor component. In spleen, however, the membrane-bound form is the major component. These two forms differ in their C-terminal segments.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp