RL36_MOUSE P47964
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P47964
Recommended name：60S ribosomal protein L36
EC number：
Alternative names：
Cleaved into：
GeneID：
Gene names (primary )：Rpl36
Gene names (synonym )：
Gene names (ORF )：
Length：105
Mass：12216
Sequence：MALRYPMAVGLNKGHKVTKNVSKPRHSRRRSRLTNHTKFVRDMIREVCGFAPYERRAMELLKVSKSKRALKFIKKRVGTHIRAKRKREELSNVLAAMEEAAAKKD
Tissue specificity：
Induction：
Developmental stage：
Protein families：Eukaryotic ribosomal protein eL36 family