ZN593_MOUSE   Q9DB42


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9DB42

Recommended name:Zinc finger protein 593

EC number:

Alternative names:(Zinc finger protein T86)

Cleaved into:

GeneID:68040

Gene names  (primary ):Znf593

Gene names  (synonym ):Zfp593

Gene names  (ORF ):

Length:134

Mass:15147

Sequence:MGRSRRTGAHRAHSLARQMKAKKRRPDLDEIHRELRPQGLPRPKPEPDAEPDPDLPGGGLHRCLACARYFIDSANLKTHFRSKDHKKRLKQLSVEPYSQEEAERAAGMGSYVQPQRLGVPTEVSTDIPEMDTST

Tissue specificity:

Induction:

Developmental stage:

Protein families:ZNF593/BUD20 C2H2-type zinc-finger protein family


   💬 WhatsApp