TM38A_MOUSE   Q3TMP8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q3TMP8

Recommended name:Trimeric intracellular cation channel type A

EC number:

Alternative names:(TRIC-A) (TRICA) (27 kDa sarcoplasmic reticulum protein) (Mitsugumin-33A) (SPR-27) (Transmembrane protein 38A)

Cleaved into:

GeneID:74166

Gene names  (primary ):Tmem38a

Gene names  (synonym ):

Gene names  (ORF ):

Length:298

Mass:33309

Sequence:MDLMSALSLGELALSFSRVPLFPVFDLSYFIVSIIYLKYEPGAVELSRRHPVASWLCAMLHCFGSYILADLLLGEPIIDYFSNSSSILLASGVWYLIFFCPLDLFYKCVCFLPVKLIFVAMKEVVRVRKIAVGIHHAHHHYHHGWFIMIATGWVKGSGVALLSNVEQLLRGVWKPETNEILHMSFPTKASLYGAILFTLQQTRWLPVSKASLIFVFTMFMVSCKVFLTATHSHSSPFDILEGYICPVLFGATWGGDHHHDNHGAPHGMGLGTQHSGLPAKAKEELGEGSRKKKTKKAD

Tissue specificity:Expressed at high levels in heart and striated muscle. Also detected in brain, lung and kidney. {ECO:0000269|PubMed:17611541}.

Induction:

Developmental stage:

Protein families:TMEM38 family


   💬 WhatsApp