S35G1_MOUSE   Q8BY79


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8BY79

Recommended name:Solute carrier family 35 member G1

EC number:

Alternative names:(Transmembrane protein 20)

Cleaved into:

GeneID:240660

Gene names  (primary ):Slc35g1

Gene names  (synonym ):Tmem20

Gene names  (ORF ):

Length:368

Mass:40217

Sequence:MGPPESAAELAAEAVELREPELQLADPASPGEEHVDVEAEGAPGRGRCWPCGAWACGSRGEPEAKKKAPCPGLGLFYTVLSAFLFSVASLFVKKVQGVHAVEISAFRCVVQMLVIIPCLIYRKTGFIGPKGQRLFLFLRGVFGSSAMILMYYAFQTTSLADATVIAFSCPVFTSIFAWIFLKEKYSLWDAFFTLFAIAGVILIVRPPFIFGSDTSGMRESYSEHIKGTFAAIGHAVLAAITLVILRKMGKSVDYFLSIWYYVILGLPEAIIILFVIGEWSLPYCGLDRLFLILIGLLGLGGQIFITKAVQIEKAGLVAIMKTMDIVFAFIFQIAFFDNVPTWWTVGGALCVVVSTTGATIRRWLQGSK

Tissue specificity:

Induction:

Developmental stage:

Protein families:TMEM20 family


   💬 WhatsApp