TR123_MOUSE P59528
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P59528
Recommended name:Taste receptor type 2 member 123
EC number:
Alternative names:(T2R123) (STC9-2) (Taste receptor type 2 member 23) (T2R23) (mT2R55)
Cleaved into:
GeneID:353167
Gene names (primary ):Tas2r123
Gene names (synonym ):T2r55 Tas2r23
Gene names (ORF ):
Length:333
Mass:38032
Sequence:MFSQKINYSHLFTFSITLYVEIVTGILGHGFIALVNIMDWVKRRRISSVDQILTALALTRFIYVLSMLICILLFMLCPHLPRRSEMLSAMGIFWVVNSHFSIWLTTCLGVFYFLKIANFSNSFFLYLKWRVKKVILIIILASLIFLTLHILSLGIYDQFSIAAYVGNMSYSLTDLTQFSSTFLFSNSSNVFLITNSSHVFLPINSLFMLIPFTVSLVAFLMLIFSLWKHHKKMQVNAKQPRDVSTMAHIKALQTVFSFLLLYAIYLLFLIIGILNLGLMEKIVILIFDHISGAVFPISHSFVLILGNSKLRQASLSVLPCLRCQSKDMDTMGL
Tissue specificity:Expressed in subsets of taste receptor cells of the tongue and palate epithelium and exclusively in gustducin-positive cells. Expressed in the duodenum, antrum and fundus (part of the stomach). {ECO:0000269|PubMed:11854532}.
Induction:
Developmental stage:
Protein families:G-protein coupled receptor T2R family