SPI2C_MOUSE   Q6NVE3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6NVE3

Recommended name:Spindlin-2C

EC number:

Alternative names:(Spindlin-like protein 2C) (SPIN-2) (SPIN-2C)

Cleaved into:

GeneID:278240

Gene names  (primary ):Spin2c

Gene names  (synonym ):Spin2

Gene names  (ORF ):

Length:257

Mass:29207

Sequence:MKTPHKKGAAKEQMGEGVGHHIGSTTIKKKKASQKRQRSRSSSRRSIVGCRISHGWKEGDEPITQWKGTVLDQVPINPSLYLVKYDGIDCVYGLELHRDERILKLKILPDKVSFSGVSDVRLANTIIGKAVEHMFEGEHGSKDEWRGMVLAQAPIMNAWFYITYERDPVLYMYQLLDDYKEGDLRIMPESSASPPADREPEGVVDGLIGKHVEYTKEDGSKRTGKVIHQVKAKPSVYFIKFDDDFHIYVYDLVKKNS

Tissue specificity:

Induction:

Developmental stage:

Protein families:SPIN/STSY family


   💬 WhatsApp