S39A9_MOUSE   Q8BFU1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8BFU1

Recommended name:Zinc transporter ZIP9

EC number:

Alternative names:(Solute carrier family 39 member 9) (Zrt- and Irt-like protein 9) (ZIP-9)

Cleaved into:

GeneID:328133

Gene names  (primary ):Slc39a9

Gene names  (synonym ):Zip9

Gene names  (ORF ):

Length:308

Mass:32368

Sequence:MDDFLSISLLSVAMLVGCYVAGIIPLAVNFSEERLKLVTVLGAGLLCGTALAVIVPEGVHALYEEVLEGKHHQTSEMKQNGIASDKAAEISSVHEHEHSHDHTQLHAYIGVSLVLGFVFMLLVDQIGSSHVHSSDDPETARPSSSKITTTLGLVVHAAADGVALGAAASTSQTSVQLIVFVAIMLHKAPAAFGLVSFLMHAGLERNRIRKHLLVFALAAPAMSMLTYLGLSKSSKEALSEVNATGVAMLFSAGTFLYVATVHVLPEVGGMGHSHKPDTTGGRGLSRLEVAALVLGCLIPLILSIGHQH

Tissue specificity:

Induction:

Developmental stage:

Protein families:ZIP transporter (TC 2.A.5) family


   💬 WhatsApp