ORNT1_MOUSE Q9WVD5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9WVD5
Recommended name：Mitochondrial ornithine transporter 1
EC number：
Alternative names：(Solute carrier family 25 member 15)
Cleaved into：
GeneID：18408
Gene names (primary )：Slc25a15
Gene names (synonym )：Ornt1
Gene names (ORF )：
Length：301
Mass：32823
Sequence：MKSNPAIQAAIDLTAGAAGGTACVLTGQPFDTMKVKMQTFPDLYRGLTDCCLKTYSQVGFRGFYKGTSPALIANIAENSVLFMCYGFCQQVVRKVVGLDQQAKLSDLQNAAAGSFASAFAALVLCPTELVKCRLQTMYEMETSGKIAASQNTVWSVVKEIFRKDGPLGFYHGLSSTLLREVPGYFFFFGGYELSRSFFASGRSKDELGPVPLMLSGGFGGICLWLAVYPVDCIKSRIQVLSMTGKQTGLVRTFLSIVKNEGITALYSGLKPTMIRAFPANGALFLAYEYSRKLMMNQLEAW
Tissue specificity：Widely expressed, with highest levels in the liver, testis and kidney. In the brain, expressed at high levels in the hypothalamus. {ECO:0000269|PubMed:19287344}.
Induction：
Developmental stage：
Protein families：Mitochondrial carrier (TC 2.A.29) family