EAA5_MOUSE   Q8JZR4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8JZR4

Recommended name:Excitatory amino acid transporter 5

EC number:

Alternative names:(Solute carrier family 1 member 7)

Cleaved into:

GeneID:242607

Gene names  (primary ):Slc1a7

Gene names  (synonym ):

Gene names  (ORF ):

Length:559

Mass:60106

Sequence:MVLDAVLARGRTVCKHNGLLILSVLSVIVGCLLGFFLRTQRLSPQEISYFQFPGELLMRMLKMLILPLVVSSLMSGLASLDAKTSSRLGILTVAYYLWTTFLAVVVGIIMVSIIHPGGAAQKETTEQSGKPVMSSADALLDLVRNMFPANLVEATFKQYRTKTTPVIKSPRGAAEEAPRRIVIYGVQEDNGSRVQNFALDLTPPPEIVYKSEPGTSDGMNVLGIVIFSATMGIMLGRMGDSGTPLVSFCQCLNESVMKIVAVAGWYFPFGIVFLIAGKILEMDDPKAVGKKLGFYAVTVVCGLVVHGLLILPLLYFLITKKNPIVFIRGVLQALLIALATSSSSATLPITFKCLLENNHIDRRIARFVLPVGATINMDGTALYEAVAAIFIAQVNNYELDFGQIITISITATAASIGAAGIPQAGLVTMVIVLTSVGLPTDDINLIIAVDWALDRFRTMINVLGDALAAGIMAHICRKDFAQDMGTEKLLPCETKPVTLQEIVAAQQNGCVKSVAEASELTLGPTCPHHIPVQVEQDEDPAAASLDHCTIEISELETNV

Tissue specificity:

Induction:

Developmental stage:

Protein families:Dicarboxylate/amino acid:cation symporter (DAACS) (TC 2.A.23) family, SLC1A7 subfamily


   💬 WhatsApp