SMD2_MOUSE   P62317


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P62317

Recommended name:Small nuclear ribonucleoprotein Sm D2

EC number:

Alternative names:(Sm-D2) (snRNP core protein D2)

Cleaved into:

GeneID:107686

Gene names  (primary ):Snrpd2

Gene names  (synonym ):

Gene names  (ORF ):

Length:118

Mass:13527

Sequence:MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK

Tissue specificity:

Induction:

Developmental stage:

Protein families:SnRNP core protein family


   💬 WhatsApp