RAGE_MOUSE Q62151
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q62151
Recommended name:Advanced glycosylation end product-specific receptor
EC number:
Alternative names:(Receptor for advanced glycosylation end products)
Cleaved into:
GeneID:11596
Gene names (primary ):Ager
Gene names (synonym ):Rage
Gene names (ORF ):
Length:402
Mass:42654
Sequence:MPAGTAARAWVLVLALWGAVAGGQNITARIGEPLVLSCKGAPKKPPQQLEWKLNTGRTEAWKVLSPQGGPWDSVARILPNGSLLLPATGIVDEGTFRCRATNRRGKEVKSNYRVRVYQIPGKPEIVDPASELTASVPNKVGTCVSEGSYPAGTLSWHLDGKLLIPDGKETLVKEETRRHPETGLFTLRSELTVIPTQGGTHPTFSCSFSLGLPRRRPLNTAPIQLRVREPGPPEGIQLLVEPEGGIVAPGGTVTLTCAISAQPPPQVHWIKDGAPLPLAPSPVLLLPEVGHEDEGTYSCVATHPSHGPQESPPVSIRVTETGDEGPAEGSVGESGLGTLALALGILGGLGVVALLVGAILWRKRQPRREERKAPESQEDEEERAELNQSEEAEMPENGAGGP
Tissue specificity:Isoform 1: Expressed at higher levels in the coronary arterioles in type 2 diabetic mice (at protein level). Endothelial cells (PubMed:18539754). Expressed in lung, kidney, brain and heart. Most prevalent isoform with the highest level in heart (PubMed:19164451). Isoform 2: Expressed in brain, lung, kidney and small intestine with the highest level in lung. Expressed in brain, lung, kidney and small intestine with the highest level in small intestine (at protein level). Detected in neurons of the cerebrum, bronchial epithelium, endothelial cells, tubular cells of kidney and epithelial cells of small intestine (at protein level). Expression is increased in the kidney of diabetic wild-type mice (at protein level), but not in the other tissues (PubMed:16503878). Expressed only in kidney. Expression is increased in the kidney of diabetic mice (PubMed:19164451). Isoform 3: Expressed in lung, kidney and heart. The second most prevalent isoform with the highest level in lung. Not expressed in brain (PubMed:19164451). Isoform 4: Expressed at very low level in lung only (PubMed:19164451). Isoform 5: Expressed at very low level in lung only (PubMed:19164451). Isoform 6: Expressed at very low level in lung only (PubMed:19164451). Isoform 7: Expressed at very low level in heart only (PubMed:19164451). Isoform 8: Expressed at very low level in lung only (PubMed:19164451). Isoform 9: Expressed at very low level in heart only (PubMed:19164451). Isoform 10: Expressed in lung, brain, heart and kidney with a very high level in kidney (PubMed:24260107). Isoform 11: Expressed in brain, kidney and heart. Not expressed in lung (PubMed:19164451). Isoform 12: Expressed at very low level in lung and kidney (PubMed:19164451). Isoform 13: Expressed at very low level in lung only (PubMed:19164451). {ECO:0000269|PubMed:16503878, ECO:0000269|PubMed:18539754, ECO:0000269|PubMed:19164451, ECO:0000269|PubMed:24260107}.
Induction:
Developmental stage:
Protein families: