RCAF1_MOUSE   Q9CQT9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9CQT9

Recommended name:Respirasome Complex Assembly Factor 1

EC number:

Alternative names:(RCAF1) (Rab5-interacting protein) (RIP5)

Cleaved into:

GeneID:67388

Gene names  (primary ):Rab5if

Gene names  (synonym ):Rcaf1

Gene names  (ORF ):

Length:129

Mass:14825

Sequence:MSGGRRKEEPPQPQLANGALKVSVWSKVLRSDAAWDDKDEFLDVIYWFRQIIALVLGVIWGVLPLRGFLGIAGFCLINAGVLYLYFSNYLQIDEEEYGGTWELTKEGFMTSFALFMVIWIIFYTAIHYD

Tissue specificity:Expressed in neuronal cells. {ECO:0000269|PubMed:31536960}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp