S10AG_MOUSE   Q9D708


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9D708

Recommended name:Protein S100-A16

EC number:

Alternative names:(Protein S100F) (S100 calcium binding protein A16)

Cleaved into:

GeneID:67860

Gene names  (primary ):S100a16

Gene names  (synonym ):

Gene names  (ORF ):

Length:124

Mass:14324

Sequence:MADCYTELEKAVVVLVENFYKYVSKHSLVKNKISKSSFRKMLQRELNHMLTDTGNRKAADKLIQNLDANHDGRICFDEYWTMIGGITSPMANLIRQQECQQESQQECQQESQQESQQESQQGSS

Tissue specificity:Ubiquitous (PubMed:17030513). Widely distributed throughout the adult brain and predominantly expressed within specific astrocyte populations (PubMed:17030513). Expressed at high level in adipose tissues of obese animals (PubMed:21266506). {ECO:0000269|PubMed:17030513, ECO:0000269|PubMed:21266506}.

Induction:

Developmental stage:

Protein families:S-100 family


   💬 WhatsApp