RAVR2_MOUSE   Q7TPD6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q7TPD6

Recommended name:Ribonucleoprotein PTB-binding 2

EC number:

Alternative names:(Protein raver-2)

Cleaved into:

GeneID:242570

Gene names  (primary ):Raver2

Gene names  (synonym ):Kiaa1579

Gene names  (ORF ):

Length:673

Mass:72031

Sequence:MAARGGGAGGAGSGSGPSAGTAGEAAEPALRPGEVAALHPQEVAARLQRMRRELSNRRKILVKNLPQDSSSQEVHELLQDYELKYCYVDRNKRTAFVTLLNGEQAQSAIQRFHQFSFRGRELTVQLQPTDALLCITNLPISFTLEEFEELVRAYGNIERCFLVYSEVTGHSKGYGFVEYMKKDFAAKARLELLGRQMGASALFAQWMDVNLLASELIHSKCLCIDKLPSDYSDSEELLQLFSGIHKPVFCQLAQDEGSHGGGFAVVEYSTAEHAEEVQQVADGITIKGSQVQLSFCAPGAPGRSTLAVLIAAQRAMHSNQKGLLPEPNPVQIMKSLNNPAMLQVLLQPQLCGRAMKPVLGVAPSLSHLLSPSLPSAILHFSKAQQSSAVGNTSSLILQNLSPLPLIQQQLMKFDNAHTNNKPGLLGEPPAMVLQPALAIGPPLPLKTDLGHHGEAHKTSNLIPPQTTLAAGLGMLPFFSNQLPAGQAGPGRGTTQEKQSASVSISEASFSGSQHYLQTFPGLPAGGPLTGNQKTPQSQPKGTEVASKNQTSLLGEPPKEIRLSKNPYLNLASVLPSVCLSTAGKGMPPKTGIASNILDAISQGSESQHALEKCIAYSPSIEDYAQASSLRNEKRGSSYLISAPEGGPVELAGQHPQDTGVSYTETYLKKKRVY

Tissue specificity:Expressed throughout embryogenesis. Detected at low levels in adult lung, brain and kidney, but not in the other tissues tested. {ECO:0000269|PubMed:16051233}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp