PXL2B_MOUSE Q9DB60
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9DB60
Recommended name：Prostamide/prostaglandin F synthase
EC number：EC 1.11.1.20
Alternative names：(Prostamide/PG F synthase) (Prostamide/PGF synthase) (Peroxiredoxin-like 2B)
Cleaved into：
GeneID：66469
Gene names (primary )：Prxl2b
Gene names (synonym )：Fam213b
Gene names (ORF )：
Length：201
Mass：21670
Sequence：MNVVDLGRVGACVLKHAVTGEAVELRSLWQEKACVVAGLRRFGCMVCRWIAQDLSNLRSILDQHDVRLVGVGPEALGLQEFLDGGYFSGELYLDESKQIYKELGFKRYNSLSILPAALGKPVRDVASKAKAVGIQGNLSGDLLQSGGLLVVSKGGDKVLLHFIQKSPGDYVPQENILQALGISAEVCSSKPPQCDEEVCGR
Tissue specificity：Mainly present in brain and spinal cord. In spinal cord, present in the superficial layer of the dorsal horn, in motor neurons of the ventral horn and in glia of the white matter of the spinal cord. In brain, expressed preferentially in the white matter bundles of the entire CNS of adult with less marked expression in neuronal cell bodies. Colocalizes with MBP in myelin sheaths but not in axons. Localizes to myelin sheaths (at protein level). {ECO:0000269|PubMed:18006499, ECO:0000269|PubMed:20950588}.
Induction：
Developmental stage：
Protein families：Peroxiredoxin-like PRXL2 family, Prostamide/prostaglandin F synthase subfamily